Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNYPLTLEMDLENLEDLFWELDRLDNYNDTSLVENHLCPATEGPLMASFK AVFVPVAYSLIFLLGVIGNVLVLVILERHRQTRSSTETFLFHLAVADLLL VFILPFAVAEGSVGWVLGTFLCKTVIALHKVNFYCSSLLLACIAVDRYLA IVHAVHAYRHRRLLSIHITCGTIWLVGFLLALPEILFAKVSQGHHNNSLP RCTFSQENQAETHAWFTSRFLYHVAGFLLPMLVMGWCYVGVVHRLRQAQR RPQRQKAVRVAILVTSIFFLCWSPYHIVIFLDTLARLKAVDNTCKLNGSL PVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQ LFPSWRRSSLSESENATSLTTF
    • Amino acids
      1 to 372
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab157964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BLR 1
    • BLR1
    • Burkitt lymphoma receptor 1
    • Burkitt lymphoma receptor 1 GTP binding protein
    • Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif) receptor 5)
    • C X C chemokine receptor type 5
    • C-X-C chemokine receptor type 5
    • CD 185
    • CD185
    • CD185 antigen
    • Chemokine (C-X-C motif) receptor 5
    • Chemokine C X C motif receptor 5
    • Chemokine CXC motif receptor 5
    • Chemokine receptor 5
    • CXC chemokine receptor type 5
    • CXC R5
    • CXC-R5
    • CXCR 5
    • CXCR-5
    • Cxcr5
    • CXCR5_HUMAN
    • MDR 15
    • MDR-15
    • MDR15
    • MGC117347
    • Monocyte derived receptor 15
    • Monocyte-derived receptor 15
    see all
  • Function
    Cytokine receptor that binds to B-lymphocyte chemoattractant (BLC). Involved in B-cell migration into B-cell follicles of spleen and Peyer patches but not into those of mesenteric or peripheral lymph nodes. May have a regulatory function in Burkitt lymphoma (BL) lymphomagenesis and/or B-cell differentiation.
  • Tissue specificity
    Expression in mature B-cells and Burkitt lymphoma cells.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab157964 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab157964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up