Recombinant Human CYB5D1 protein (ab165220)

Overview

  • Product name
    Recombinant Human CYB5D1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPRRGLVAGPDLEYFQRRYFTPAEVAQHNRPEDLWVSYLGRVYDLTSLAQ EYKGNLLLKPIVEVAGQDISHWFDPKTRDIRKHIDPLTGCLRYCTPRGRF VHVPPQLPCSDWANDFGKPWWQGSYYEVGRLSAKTRSIRIINTLTSQEHT LEVGVLESIWEILHRYLPYNSHAASYTWKYEGKNLNMDFTLEENGIRDEE EEFDYLSMDGTLHTPAILLYFNDDLTEL
    • Amino acids
      1 to 228
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165220 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYB5D 1
    • Cytochrome b5 domain containing 1
    • Cytochrome b5 domain containing protein 1
    • FLJ32499
    • Gm740
    • MGC118302
    • RP23 5O23.2
    see all
  • Relevance
    CYB5D1 belongs to the cytochrome b5 family and contains 1 cytochrome b5 heme-binding domain. Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts. There are 2 named isoforms produced by alternative splicing.

Images

  • ab165220 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165220 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165220.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up