Recombinant Human CYB5R4 protein (ab162439)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLNVPSQSFPAPRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGL KGRLIEVTEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDELMRAA GSDGTELFDQVHRWVNYESMLKECLVGRMAIKPAVLKDYREEEKKVLNGM LPKSQVTDTLAKEGPSYPSYDWFQTDSLVTIAIYTKQKDINLDSIIVDHQ NDSFRAETIIKDCLYLIHIGLSHEVQEDFSVRVVESVGKIEIVLQKKENT SWDFLGHPLKNHNSLIPRKDTGLYYRKCQLISKEDVTHDTRLFCLMLPPS THLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYF LIKIYPTGLFTPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGT GFTPMVKILNYALTDIPSLRKVKLMFFNKTEDDIIWRSQLEKLAFKDKRL DVEFVLSAPISEWNGKQGHISPALLSEFLKRNLDKSKVLVCICGPVPFTE QGVRLLHDLNFSKNEIHSFTA
    • Amino acids
      1 to 521
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162439 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • b5+b5R
    • b5b5r
    • C79736
    • cb5/cb5R
    • Cb5cb5r
    • Cyb5r4
    • Cytochrome b type NAD(P)H oxidoreductase
    • Cytochrome b5 reductase 4
    • dJ676J13.1
    • Flavohemoprotein b5+b5R
    • Flavohemoprotein b5/b5R
    • N terminal cytochrome b5 and cytochrome b5 oxidoreductase domain containing protein
    • N-terminal cytochrome b5 and cytochrome b5 oxidoreductase domain-containing protein
    • NADPH cytochrome B5 oxidoreductase
    • NB5R4_HUMAN
    • NCB5OR
    • RP4 676J13.1
    see all
  • Function
    NADH-cytochrome b5 reductase involved in endolasmic reticulum stress response pathway. Plays a critical role in protecting pancreatic beta-cells against oxidant stress, possibly by protecting the cell from excess buildup of reactive oxygen species (ROS). Reduces a variety of substrates in vitro, such as cytochrome c, feericyanide and methemoglobin.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 CS domain.
    Contains 1 cytochrome b5 heme-binding domain.
    Contains 1 FAD-binding FR-type domain.
  • Cellular localization
    Endoplasmic reticulum. Soluble protein.
  • Information by UniProt

Images

  • ab162439 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162439 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162439.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up