Recombinant Human Cyclin D1 protein (ab85247)

Overview

  • Product name
    Recombinant Human Cyclin D1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQK EVLPSMRKIVATWMLEVCEE QKCEEEVFPLAMNYLDRFLSLEPVKKSR LQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQM ELLLVN KLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFI SNPPSMVAAGSVVA AVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCL RACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEE VDLACTPTDVRD VDI
    • Amino acids
      1 to 295
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab85247 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 0.25mM DTT, 0.1mM PMSF, pH 7.5

General Info

  • Alternative names
    • AI327039
    • B cell CLL/lymphoma 1
    • B cell leukemia 1
    • B cell lymphoma 1 protein
    • B-cell lymphoma 1 protein
    • BCL 1
    • BCL-1
    • BCL-1 oncogene
    • BCL1
    • BCL1 oncogene
    • ccnd1
    • CCND1/FSTL3 fusion gene, included
    • CCND1/IGHG1 fusion gene, included
    • CCND1/IGLC1 fusion gene, included
    • CCND1/PTH fusion gene, included
    • CCND1_HUMAN
    • cD1
    • Cyl 1
    • D11S287E
    • G1/S specific cyclin D1
    • G1/S-specific cyclin-D1
    • Parathyroid adenomatosis 1
    • PRAD1
    • PRAD1 oncogene
    • U21B31
    see all
  • Function
    Essential for the control of the cell cycle at the G1/S (start) transition.
  • Involvement in disease
    Note=A chromosomal aberration involving CCND1 may be a cause of B-lymphocytic malignancy, particularly mantle-cell lymphoma (MCL). Translocation t(11;14)(q13;q32) with immunoglobulin gene regions. Activation of CCND1 may be oncogenic by directly altering progression through the cell cycle.
    Note=A chromosomal aberration involving CCND1 may be a cause of parathyroid adenomas. Translocation t(11;11)(q13;p15) with the parathyroid hormone (PTH) enhancer.
    Defects in CCND1 are a cause of multiple myeloma (MM) [MIM:254500]. MM is a malignant tumor of plasma cells usually arising in the bone marrow and characterized by diffuse involvement of the skeletal system, hyperglobulinemia, Bence-Jones proteinuria and anemia. Complications of multiple myeloma are bone pain, hypercalcemia, renal failure and spinal cord compression. The aberrant antibodies that are produced lead to impaired humoral immunity and patients have a high prevalence of infection. Amyloidosis may develop in some patients. Multiple myeloma is part of a spectrum of diseases ranging from monoclonal gammopathy of unknown significance (MGUS) to plasma cell leukemia. Note=A chromosomal aberration involving CCND1 is found in multiple myeloma. Translocation t(11;14)(q13;q32) with the IgH locus.
  • Sequence similarities
    Belongs to the cyclin family. Cyclin D subfamily.
  • Post-translational
    modifications
    Phosphorylation at Thr-286 by MAP kinases is required for ubiquitination and degradation following DNA damage. It probably plays an essential role for recognition by the FBXO31 component of SCF (SKP1-cullin-F-box) protein ligase complex.
    Ubiquitinated, primarily as 'Lys-48'-linked polyubiquitination. Ubiquitinated by a SCF (SKP1-CUL1-F-box protein) ubiquitin-protein ligase complex containing FBXO4 and CRYAB (By similarity). Following DNA damage it is ubiquitinated by some SCF (SKP1-cullin-F-box) protein ligase complex containing FBXO31. Ubiquitination leads to its degradation and G1 arrest. Deubiquitinated by USP2; leading to stabilize it.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

References

ab85247 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab85247.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up