Recombinant Human Cyclin G protein (ab114783)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTAR LRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLS CFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVK ATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKP SVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLT EYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 295

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCNG
    • CCNG 1
    • CCNG1
    • CCNG1_HUMAN
    • CYCG1
    • Cyclin G
    • Cyclin G1
    • Cyclin-G
    • Cyclin-G1
    see all
  • Function
    May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation.
  • Tissue specificity
    High levels in skeletal muscle, ovary, kidney and colon.
  • Sequence similarities
    Belongs to the cyclin family. Cyclin G subfamily.
  • Developmental stage
    Very low levels in normal cells during G1 phase, which increase as cells enter the S phase and stay high throughout the S and G2/M phases. In breast cancer cells consistent high levels are found throughout the cell cycle.
  • Cellular localization
    Nucleus. DNA replication foci after DNA damage.
  • Information by UniProt

Recombinant Human Cyclin G protein images

  • ab114783 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Cyclin G protein (ab114783)

ab114783 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up