Recombinant Human Cyclin G protein (ab114783)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTAR LRDFEVKDLLSLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLS CFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKIVLEKVCWKVK ATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKP SVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLT EYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 295

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114783 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CCNG
    • CCNG 1
    • CCNG1
    • CCNG1_HUMAN
    • CYCG1
    • Cyclin G
    • Cyclin G1
    • Cyclin-G
    • Cyclin-G1
    see all
  • Function
    May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation.
  • Tissue specificity
    High levels in skeletal muscle, ovary, kidney and colon.
  • Sequence similarities
    Belongs to the cyclin family. Cyclin G subfamily.
  • Developmental stage
    Very low levels in normal cells during G1 phase, which increase as cells enter the S phase and stay high throughout the S and G2/M phases. In breast cancer cells consistent high levels are found throughout the cell cycle.
  • Cellular localization
    Nucleus. DNA replication foci after DNA damage.
  • Information by UniProt

Images

  • ab114783 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114783 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114783.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up