Recombinant Human Cyclin G protein (ab116149)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMIEVLTTTDSQKLLHQLNALLEQESRCQPK VCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDTETFSLAVNLL DRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFT VSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFE RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKCVELTEGIECLQKH SKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS YYRITHLPTIPEMVP
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 295
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab116149 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 1.17% Sodium chloride, 0.08% DTT, 50% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names
    • CCNG
    • CCNG 1
    • CCNG1
    • CCNG1_HUMAN
    • CYCG1
    • Cyclin G
    • Cyclin G1
    • Cyclin-G
    • Cyclin-G1
    see all
  • Function
    May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation.
  • Tissue specificity
    High levels in skeletal muscle, ovary, kidney and colon.
  • Sequence similarities
    Belongs to the cyclin family. Cyclin G subfamily.
  • Developmental stage
    Very low levels in normal cells during G1 phase, which increase as cells enter the S phase and stay high throughout the S and G2/M phases. In breast cancer cells consistent high levels are found throughout the cell cycle.
  • Cellular localization
    Nucleus. DNA replication foci after DNA damage.
  • Information by UniProt

Recombinant Human Cyclin G protein images

  • 15% SDS-PAGE showing ab116149 3ug.

References for Recombinant Human Cyclin G protein (ab116149)

ab116149 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up