Recombinant Human Cyclin H protein (ab174062)

Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEP HEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYH PRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLL IQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIAL TDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLD IMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDD DYVSKKSKHEEEEWTDDDLVESL
    • Molecular weight
      39 kDa including tags
    • Amino acids
      1 to 323
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab174062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

  • Purity
    > 90 % Densitometry.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • 6330408H09Rik
    • AI661354
    • AV102684
    • AW538719
    • CAK
    • CAK complex subunit
    • ccnh
    • CCNH_HUMAN
    • CDK activating kinase
    • CDK activating kinase complex subunit
    • Cyclin dependent kinase activating kinase
    • cyclin dependent kinase activating kinase complex subunit
    • Cyclin H
    • Cyclin-H
    • CyclinH
    • MO15 associated protein
    • MO15-associated protein
    • p34
    • p36
    • p37
    see all
  • Function
    Regulates CDK7, the catalytic subunit of the CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminus domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II. Its expression and activity are constant throughout the cell cycle.
  • Sequence similarities
    Belongs to the cyclin family. Cyclin C subfamily.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE showing ab174062

References

ab174062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up