Recombinant Human Cyclin T2 protein (ab116752)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60583
    • SpeciesHuman
    • SequenceRKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQKPSTSAFPAPV PLNSGNISVQDSHTSDNLSMLATGMPSTSYGLSSHQEWPQHQDSARTEQL YSQKQET
    • Molecular weight37 kDa including tags
    • Amino acids264 to 370

Specifications

Our Abpromise guarantee covers the use of ab116752 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CCNT2
    • CCNT2_HUMAN
    • Cyclin T2a
    • Cyclin T2b
    • Cyclin-T2
    • CycT2
    • FLJ90560
    • MGC134840
    • SDS stable vimentin bound DNA fragment HEF42VIM22
    • Subunit of positive elongation transcription factor b
    see all
  • FunctionRegulatory subunit of the cyclin-dependent kinase pair (CDK9/cyclin T) complex, also called positive transcription elongation factor B (P-TEFB), which is proposed to facilitate the transition from abortive to production elongation by phosphorylating the CTD (carboxy-terminal domain) of the large subunit of RNA polymerase II (RNAP II).
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesBelongs to the cyclin family. Cyclin C subfamily.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Cyclin T2 protein images

  • 12.5% SDS-PAGE analysis of ab116752 at approximately 37.40kDa, stained with Coomassie Blue.

References for Recombinant Human Cyclin T2 protein (ab116752)

ab116752 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116752.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"