Recombinant Human Cyclophilin A protein (ab186086)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKG SCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSM ANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNG KTSKKITIADCGQLE
    • Molecular weight
      18 kDa
    • Amino acids
      1 to 165
    • Additional sequence information
      Length with Tag (aa): 385

Specifications

Our Abpromise guarantee covers the use of ab186086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    >95% by SDS-PAGE .
    ab186086 is purified by proprietary tag / Glutathione Sepharose affinity chromatography.
  • Form
    Lyophilised
  • Additional notes

    Prior to reconstitution, store the lyophilized protein at 2-8ºC. After reconstitution, store in working aliquots at -80ºC.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Please see notes section.

    Constituents: 0.605% Tris, 0.31% Glutathione

  • Reconstitution
    Reconstitute the contents of the vial using ultrapure water or sterile PBS to prepare a stock solution of 0.5 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 2-8ºC for up to 1 week. For extended storage, freeze in working aliquots

General Info

  • Alternative names
    • Cyclophilin
    • Cyclophilin A
    • CyclophilinA
    • Cyclosporin A binding protein
    • Cyclosporin A-binding protein
    • CYPA
    • CYPH
    • Epididymis secretory sperm binding protein Li 69p
    • HEL S 69p
    • MGC117158
    • MGC12404
    • MGC23397
    • Peptidyl prolyl cis trans isomerase A
    • Peptidyl-prolyl cis-trans isomerase A
    • Peptidylprolyl isomerase A
    • Peptidylprolyl isomerase A (cyclophilin A)
    • PPIA
    • PPIA protein
    • PPIA_HUMAN
    • PPIase A
    • Rotamase A
    • RotamaseA
    • T cell cyclophilin
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIase A subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab186086 stained with Coomassie Blue.

References

ab186086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab186086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up