Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVP KTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG KVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Specifications

Our Abpromise guarantee covers the use of ab86219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific activity is > 270 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant Cyclophilin A protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Sodium chloride, 20mM Tris, 0.5mM DTT, pH 8

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Cyclophilin
    • Cyclophilin A
    • CyclophilinA
    • Cyclosporin A binding protein
    • Cyclosporin A-binding protein
    • CYPA
    • CYPH
    • Epididymis secretory sperm binding protein Li 69p
    • HEL S 69p
    • MGC117158
    • MGC12404
    • MGC23397
    • Peptidyl prolyl cis trans isomerase A
    • Peptidyl-prolyl cis-trans isomerase A
    • Peptidylprolyl isomerase A
    • Peptidylprolyl isomerase A (cyclophilin A)
    • PPIA
    • PPIA protein
    • PPIA_HUMAN
    • PPIase A
    • Rotamase A
    • RotamaseA
    • T cell cyclophilin
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIase A subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS Page analysis of 3ug ab86219

References

This product has been referenced in:
  • Sánchez JA  et al. Spongionella Secondary Metabolites, Promising Modulators of Immune Response through CD147 Receptor Modulation. Front Immunol 7:452 (2016). Read more (PubMed: 27822214) »

See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab86219.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up