Recombinant human Cyclophilin A protein (ab86219)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVP KTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFG KVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

Specifications

Our Abpromise guarantee covers the use of ab86219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity is > 270 nmoles/min/mg, and is defined as the amount of enzyme that cleaves 1 µmole of suc-AAFP-pNA per minute at 25°C in Tris-Hcl pH8.0 using chymotrypsin.

    Activity Assay

    1. Prepare 170 µl assay buffer into a suitable container and pre-chill on ice before use: The final concentrations are 200 mM Tris-Hcl, pH 8.0, and 20nM chymotrypsin.
    2. Add 10 µl of recombinant Cyclophilin A protein with 1 µg in assay buffer.
    3. Mix by inversion and equilibrate to 1°C and monitor the A405nm until the value is constant using a spectrophotometer.
    4. Add 20 µl pre-chilled 5mM suc-AAFP-pNA. (Substrate was dissolved in TFE that contained 460mM LiCl to a concentration of 3 mM)
    5. Record the increase in A405 nm for 30 minutes at 25°C.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level< 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Sodium chloride, 20mM Tris, 0.5mM DTT, pH 8

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Cyclophilin
    • Cyclophilin A
    • CyclophilinA
    • Cyclosporin A binding protein
    • Cyclosporin A-binding protein
    • CYPA
    • CYPH
    • Epididymis secretory sperm binding protein Li 69p
    • HEL S 69p
    • MGC117158
    • MGC12404
    • MGC23397
    • Peptidyl prolyl cis trans isomerase A
    • Peptidyl-prolyl cis-trans isomerase A
    • Peptidylprolyl isomerase A
    • Peptidylprolyl isomerase A (cyclophilin A)
    • PPIA
    • PPIA protein
    • PPIA_HUMAN
    • PPIase A
    • Rotamase A
    • RotamaseA
    • T cell cyclophilin
    see all
  • FunctionPPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similaritiesBelongs to the cyclophilin-type PPIase family. PPIase A subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant human Cyclophilin A protein images

  • 15% SDS Page analysis of 3ug ab86219

References for Recombinant human Cyclophilin A protein (ab86219)

ab86219 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab86219.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"