Recombinant Human Cyclophilin A protein (BSA and azide free) (ab175466)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGS CFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMA NAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGK TSKKITIADCGQLE
    • Molecular weight
      19 kDa including tags
    • Amino acids
      2 to 165
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab175466 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    Mass Spectrometry

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    LC-MS/MS
  • Purity
    > 95 % Densitometry.

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at +4°C short term (1-2 weeks). Store at -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

  • Reconstitution
    Add 200 µl of deionized water to prepare a working stock solution of approximately 0.5 mg/ml.

General Info

  • Alternative names
    • Cyclophilin
    • Cyclophilin A
    • CyclophilinA
    • Cyclosporin A binding protein
    • Cyclosporin A-binding protein
    • CYPA
    • CYPH
    • Epididymis secretory sperm binding protein Li 69p
    • HEL S 69p
    • MGC117158
    • MGC12404
    • MGC23397
    • Peptidyl prolyl cis trans isomerase A
    • Peptidyl-prolyl cis-trans isomerase A
    • Peptidylprolyl isomerase A
    • Peptidylprolyl isomerase A (cyclophilin A)
    • PPIA
    • PPIA protein
    • PPIA_HUMAN
    • PPIase A
    • Rotamase A
    • RotamaseA
    • T cell cyclophilin
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIase A subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab175466, 1) Reduced and heated sample, 2.5 μg/lane; 2) Non-reduced and non-heated sample, 2.5 μg/lane.

References

ab175466 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175466.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up