Recombinant Human Cyclophilin B protein (ab179977)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DEKKKGPKVTVKVYFDLRIGDEDVGRVIFGLFGKTVPKTVDNFVALATGE KGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYGERFPDENFKLKHY GPGWVSMANAGKDTNGSQFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVE STKTDSRDKPLKDVIIADCGKIEVEKPFA
    • Molecular weight
      21 kDa including tags
    • Amino acids
      34 to 212
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Accession NP_000933.

Specifications

Our Abpromise guarantee covers the use of ab179977 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at 4°C prior to reconstitution. Store at -20°C or -80°C. Reconstitute for long term storage.

    pH: 7.40
    Constituents: 95% PBS, 5% Trehalose

General Info

  • Alternative names
    • AA408962
    • AA553318
    • AI844835
    • Cphn 2
    • Cphn2
    • Cyclophilin B
    • Cyclophilin like protein
    • CyP 20b
    • CYP S1
    • CYP-S1
    • CYPB
    • EC 5.2.1.8
    • MGC14109
    • MGC2224
    • OI9
    • peptidyl prolyl cis trans isomerase B
    • Peptidyl prolyl cis trans isomerase B precursor
    • Peptidyl-prolyl cis-trans isomerase B
    • Peptidylprolyl isomerase B
    • peptidylprolyl isomerase B (cyclophilin B)
    • PPIase
    • PPIase B
    • Ppib
    • PPIB_HUMAN
    • Rotamase
    • Rotamase B
    • S cyclophilin
    • S-cyclophilin
    • SCYLP
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Involvement in disease
    Defects in PPIB are the cause of osteogenesis imperfecta type 9 (OI9) [MIM:259440]. OI9 is a connective tissue disorder characterized by bone fragility, low bone mass and bowing of limbs due to multiple fractures. Short limb dwarfism and blue sclerae are observed in some but not all patients.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIase B subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization
    Endoplasmic reticulum lumen. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab179977 stained overnight with Coomassie Blue.

    ab179977 migrates as 22 kDa due to glycosylation.

References

ab179977 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179977.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up