Recombinant Human Cyclophilin B protein (ab88801)

Overview

Description

  • Nature
    Recombinant
  • Source
    Saccharomyces cerevisiae
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDL RIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIK DFM IQGGDFTRGDGTGGKSIYGERFPDENFKLKHYGPGWVSMANAGKD TNGS QFFITTVKTAWLDGKHVVFGKVLEGMEVVRKVESTKTDSRDKPL KDVIIA DCGKIEVEKPFAIAKE

Specifications

Our Abpromise guarantee covers the use of ab88801 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab88801 was purified by affinity chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • AA408962
    • AA553318
    • AI844835
    • Cphn 2
    • Cphn2
    • Cyclophilin B
    • Cyclophilin like protein
    • CyP 20b
    • CYP S1
    • CYP-S1
    • CYPB
    • EC 5.2.1.8
    • MGC14109
    • MGC2224
    • OI9
    • peptidyl prolyl cis trans isomerase B
    • Peptidyl prolyl cis trans isomerase B precursor
    • Peptidyl-prolyl cis-trans isomerase B
    • Peptidylprolyl isomerase B
    • peptidylprolyl isomerase B (cyclophilin B)
    • PPIase
    • PPIase B
    • Ppib
    • PPIB_HUMAN
    • Rotamase
    • Rotamase B
    • S cyclophilin
    • S-cyclophilin
    • SCYLP
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Involvement in disease
    Defects in PPIB are the cause of osteogenesis imperfecta type 9 (OI9) [MIM:259440]. OI9 is a connective tissue disorder characterized by bone fragility, low bone mass and bowing of limbs due to multiple fractures. Short limb dwarfism and blue sclerae are observed in some but not all patients.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family. PPIase B subfamily.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization
    Endoplasmic reticulum lumen. Melanosome. Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
  • Information by UniProt

References

ab88801 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your recent telephone enquiry.

I can confirm that the full sequence forab88801 Cyclophilin B protein (Human)is as follows:

MLRLSERNMKVLLAAALIAGSVFFLLLPGPSAADEKKKGPKVTVKVYFDL
RIGDEDVGRVIFGLFGKTVPKTVDNFVALATGEKGFG...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up