Recombinant Human Cyclophilin F protein (ab169897)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGEFMLALRCGSRWLGLLSVPRSVPLRLPAARACSKGSG DPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGE KGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHV GPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIE SFGSKSGRTSKKIVITDCGQLS
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 207
    • Tags
      T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169897 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169897 was expressed in E.coli as inclusion bodies, then refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and Glycerol

General Info

  • Alternative names
    • Cyclophilin 3
    • cyclophilin D
    • Cyclophilin F
    • Cyp D
    • CyP M
    • CYP3
    • CypD
    • hCyP3
    • mitochondrial
    • Mitochondrial cyclophilin
    • Peptidyl prolyl cis trans isomerase, mitochondral
    • Peptidyl-prolyl cis-trans isomerase F
    • Peptidyl-prolyl cis-trans isomerase F, mitochondrial
    • Peptidylprolyl isomerase F
    • Peptidylprolyl isomerase F (cyclophilin F)
    • PPIase
    • PPIase F
    • Ppif
    • PPIF_HUMAN
    • Rotamase
    • Rotamase F
    see all
  • Function
    PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
  • Sequence similarities
    Belongs to the cyclophilin-type PPIase family.
    Contains 1 PPIase cyclophilin-type domain.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

References

ab169897 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169897.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up