Recombinant Human CYFIP2 protein (ab162051)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YGVIIPYPPSNRYETLLKQRHVQLLGRSIDLNRLITQRISAAMYKSLDQA ISRFESEDLTSIVELEWLLEINRLTHRLLCKHMTLDSF
    • Amino acids
      733 to 820
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162051 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYFP2
    • cytoplasmic FMR1 interacting protein 2
    • KIAA1168
    • p53 inducible protein
    • p53-inducible protein 121
    • PIR121
    see all
  • Relevance
    CYFIP2 is involved in T cell adhesion and p53 dependent induction of apoptosis. It does not bind RNA but is up regulated significantly in CD4+ T lymphocytes from patients with multiple sclerosis. There are 2 isoforms produced by alternative splicing.
  • Cellular localization
    Cytoplasm perinuclear region. Cell junction, synapse, synaptosome. Treatment with leptomycin-B triggers translocation to the nucleus.

Images

  • ab162051 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162051 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162051.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up