Recombinant Human CYP11A1 protein (ab152319)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KTLVQVAIYALGREPTFFFDPENFDPTRWLSKDKNITYFRNLGFGWGVRQ CLGRRIAELEMTIFLINMLENFRVEIQHLSDVGTTFNLILMPEKPISFTF WPFNQEATQQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      412 to 521

Specifications

Our Abpromise guarantee covers the use of ab152319 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cholesterol 20 22 desmolase
    • Cholesterol desmolase
    • Cholesterol monooxygenase (side chain cleaving)
    • Cholesterol side chain cleavage enzyme
    • Cholesterol side chain cleavage enzyme mitochondrial
    • Cholesterol side-chain cleavage enzyme
    • CP11A_HUMAN
    • CYP11A
    • CYP11A1
    • CYPXIA1
    • Cytochrome P450 11A1
    • Cytochrome P450 11A1 mitochondrial
    • Cytochrome P450 family 11 subfamily A polypeptide 1
    • Cytochrome P450 subfamily XIA
    • Cytochrome P450(scc)
    • Cytochrome P450C11A1
    • mitochondrial
    • P450SCC
    • Steroid 20 22 lyase
    see all
  • Function
    Catalyzes the side-chain cleavage reaction of cholesterol to pregnenolone.
  • Pathway
    Lipid metabolism; C21-steroid hormone metabolism.
  • Involvement in disease
    Defects in CYP11A1 are a cause of congenital adrenal insufficiency (CAI).
    Defects in CYP11A1 are a cause of congenital lipoid adrenal hyperplasia (CLAH) [MIM:201710]; also known as lipoid CAH. CLAH is the most severe form of adrenal hyperplasia. This autosomal recessive and potentially lethal condition includes the onset of profound adrenocortical insufficiency shortly after birth, hyperpigmentation reflecting increased production of pro-opiomelanocortin, elevated plasma renin activity as a consequence of reduced aldosterone synthesis, and male pseudohermaphroditism resulting from deficient fetal testicular testosterone synthesis. CLAH is a rare disease, except in Japan and Korea where it accounts for a significant percentage of cases of congenital adrenal hyperplasia.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152319 stained with Coomassie Blue.

References

ab152319 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152319.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up