Recombinant Human CYP24A1 protein (ab152322)

Overview

  • Product name
    Recombinant Human CYP24A1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LMLNTQVLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIG RRLAELQLHLALCWIVRKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      415 to 514

Specifications

Our Abpromise guarantee covers the use of ab152322 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1
    • 1 25 @dihydroxyvitamin D3 24 hydroxylase
    • 1 25 dihydroxyvitamin D(3) 24 hydroxylase
    • 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
    • 24 OHase
    • 24-OHase
    • 25-dihydroxyvitamin D(3) 24-hydroxylase
    • CP 24
    • CP24
    • CP24A_HUMAN
    • CYP 24
    • CYP24
    • CYP24A1
    • Cytochrome P450 24A1
    • Cytochrome P450 24A1 mitochondrial
    • cytochrome P450 CC24
    • Cytochrome P450 family 24
    • Cytochrome P450 family 24 subfamily A member 1
    • Cytochrome P450 family 24 subfamily A polypeptide 1
    • Cytochrome P450 subfamily XXIV
    • Cytochrome P450, subfamily XXIV (vitamin D 24-hydroxylase)
    • Cytochrome P450-CC24
    • EC 1.14.13.n4
    • Exo mitochondrial protein
    • HCAI
    • HCINF1
    • MGC126273
    • MGC126274
    • mitochondrial
    • P450 CC24
    • Vitamin D 24 hydroxylase
    • Vitamin D(3) 24 hydroxylase
    • Vitamin D(3) 24-hydroxylase
    see all
  • Function
    Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152322 stained with Coomassie Blue.

References

ab152322 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152322.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up