Recombinant Human CYP27B1 protein (ab158259)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLCHYATSRDPAQFPEPNSFRPARWLGEGPTPHPFASLPFGFGKRSCMGR RLAELELQMALAQILTHFEVQPEPGAAPVRPKTRTVLVPERSINLQFLDR
    • Amino acids
      409 to 508
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158259 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1alpha(OH)ase
    • 25-hydroxyvitamin D(3) 1-alpha-hydroxylase
    • 25-hydroxyvitamin D-1 alpha hydroxylase
    • 25-OHD-1 alpha-hydroxylase
    • Calcidiol 1-monooxygenase
    • CP27B_HUMAN
    • CP2B
    • CYP1
    • CYP1ALPHA
    • CYP27B
    • Cyp27b1
    • Cytochrome p450 27B1
    • Cytochrome p450 27B13
    • Cytochrome P450 family 27 subfamily B polypeptide 1
    • Cytochrome P450 subfamily XXVIIB (25-hydroxyvitamin D-1-alpha-hydroxylase) polypeptide 1
    • Cytochrome P450 subfamily XXVIIB polypeptide 1
    • Cytochrome P450C1 alpha
    • Cytochrome P450VD1-alpha
    • mitochondrial
    • P450c1
    • P450C1 alpha
    • P450C1-alpha
    • P450VD1-alpha
    • PDDR
    • VD3 1A hydroxylase
    • VDD1
    • VDDR
    • VDDR I
    • VDDRI
    • VDR
    see all
  • Function
    Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation.
  • Tissue specificity
    Kidney.
  • Pathway
    Hormone biosynthesis; cholecalciferol biosynthesis.
  • Involvement in disease
    Defects in CYP27B1 are the cause of rickets vitamin D-dependent type 1A (VDDR1A) [MIM:264700]; also known as pseudovitamin D deficiency rickets (PDDR). A disorder caused by a selective deficiency of the active form of vitamin D (1,25-dihydroxyvitamin D3) and resulting in defective bone mineralization and clinical features of rickets.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Mitochondrion membrane.
  • Information by UniProt

Images

  • ab158259 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158259 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158259.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up