Recombinant Human CYP2C8 protein (ab158250)

Overview

  • Product name
    Recombinant Human CYP2C8 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEPFVVLVLCLSFMLLFSLWRQSCRRRKLPPGPTPLPIIGNMLQIDVKDI CKSFTNFSKVYGPVFTVYFGMNPIVVFHGYESVKEALIDNGEEFSGRGNS PISQRITKGLGIISSNGKRWKEIRRFSLTTLRNFGMGKRSIEDRVQEEAH CLVEELRKTKASPCDPTFILGCAPCNVICSVVFQKRFDYKDQNFLTLMKR FNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKE HQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAGTE TTSTTLRYGLLLLLKHPEVTAKVQEEIDHVIGRHRSPCMQDRSHMPYTDA VVHEIQRYSDLVPTGVPHAVTTDTKFRNYLIPKGTTIMALLTSVLHDDKE FPNPNIFDPGHFLDKNGNFKKSDYFMPFSAGKRICAGEGLARMELFLFLT TILQNFNLKSVDDLKNLNTTAVTKGIVSLPPSYQICFIPV
    • Amino acids
      1 to 490
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158250 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Purity
    83 % Proprietary Purification.

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP2C8_HUMAN
    • CPC8
    • CYP2C8
    • CYPIIC8
    • Cytochrome P450 2C8
    • Cytochrome P450 family 2 subfamily C polypeptide 8
    • Cytochrome P450 form 1
    • Cytochrome P450 IIC2
    • Cytochrome P450 MP-12
    • Cytochrome P450 MP-20
    • Cytochrome P450 subfamily IIC (mephenytoin 4 hydroxylase) polypeptide 8
    • Flavoprotein linked monooxygenase
    • Microsomal monooxygenase
    • MP 12/MP 20
    • P450 form 1
    • P450 IIC2
    • P450 MP 12/MP 20
    • S mephenytoin 4 hydroxylase
    • S-mephenytoin 4-hydroxylase
    • Xenobiotic monooxygenase
    see all
  • Function
    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. In the epoxidation of arachidonic acid it generates only 14,15- and 11,12-cis-epoxyeicosatrienoic acids. It is the principal enzyme responsible for the metabolism the anti-cancer drug paclitaxel (taxol).
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab158250 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158250 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158250.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up