Recombinant Human CYP2R1 protein (ab165164)

Overview

  • Product name
    Recombinant Human CYP2R1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWKLWRAEEGAAALGGALFLLLFALGVRQLLKQRRPMGFPPGPPGLPFIG NIYSLAASSELPHVYMRKQSQVYGEIFSLDLGGISTVVLNGYDVVKECLV HQSEIFADRPCLPLFMKMTKMGGLLNSRYGRGWVDHRRLAVNSFRYFGYG QKSFESKILEETKFFNDAIETYKGRPFDFKQLITNAVSNITNLIIFGERF TYEDTDFQHMIELFSENVELAASASVFLYNAFPWIGILPFGKHQQLFRNA AVVYDFLSRLIEKASVNRKPQLPQHFVDAYLDEMDQGKNDPSSTFSKENL IFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKP SWDDKCKMPYTEAVLHEVLRFCNIVPLGIFHATSEDAVVRGYSIPKGTTV ITNLYSVHFDEKYWRDPEVFHPERFLDSSGYFAKKEALVPFSLGRRHCLG EHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLGMTLQPQPYLICAER R
    • Amino acids
      1 to 501
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP2R1_HUMAN
    • CYP2R1
    • Cytochrome P450 2R1
    • Cytochrome P450 family 2 R1
    • Cytochrome P450 family 2 subfamily R polypeptide 1
    • EC 1.14.13.15
    • MGC4663
    • Vitamin D 25 hydroxylase
    • Vitamin D 25-hydroxylase
    see all
  • Function
    Has a D-25-hydroxylase activity on both forms of vitamin D, vitamin D(2) and D(3).
  • Involvement in disease
    Defects in CYP2R1 are the cause of rickets vitamin D-dependent type 1B (VDDR1B) [MIM:600081]; also known as pseudovitamin D(3) deficiency rickets due to 25-hydroxylase deficiency. A disorder caused by a selective deficiency of the active form of vitamin D (1,25-dihydroxyvitamin D3) and resulting in defective bone mineralization and clinical features of rickets. The patients sera have low calcium concentrations, low phosphate concentrations, elevated alkaline phosphatase activityand low levels of 25-hydroxyvitamin D.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab165164 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165164 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up