Recombinant Human CYP4F3 protein (ab117046)

Overview

  • Product name
    Recombinant Human CYP4F3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRR MLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
    • Molecular weight
      37 kDa including tags
    • Amino acids
      100 to 198

Specifications

Our Abpromise guarantee covers the use of ab117046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP4F3_HUMAN
    • CPF3
    • CYP4F
    • Cyp4f3
    • CYPIVF3
    • Cytochrome P450 4F3
    • Cytochrome P450 LTB omega
    • Cytochrome P450, family 4, subfamily F, polypeptide 3
    • Cytochrome P450, subfamily IVF, polypeptide 3
    • Cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase)
    • Cytochrome P450-LTB-omega
    • Leukotriene B(4) 20 monooxygenase
    • Leukotriene B(4) omega hydroxylase
    • leukotriene B4 omega hydroxylase
    • Leukotriene-B(4) 20-monooxygenase 2
    • Leukotriene-B(4) omega-hydroxylase 2
    • leukotriene-B4 20-monooxygenase
    • LTB4 omega-hydroxylase
    • LTB4H
    see all
  • Function
    Cytochromes P450 are a group of heme-thiolate monooxygenases. This enzyme requires molecular oxygen and NADPH for the omega-hydroxylation of LTB4, a potent chemoattractant for polymorphonuclear leukocytes.
  • Tissue specificity
    Expressed in the polymorphonuclear leukocytes as well as leukocytes.
  • Pathway
    Lipid metabolism; leukotriene B4 degradation.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117046 at approximately 36.52 kDa.

References

ab117046 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up