Recombinant Human CYP4F3 protein (ab117046)

Overview

  • Product name
    Recombinant Human CYP4F3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRR MLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARLDMFEHISLM
    • Molecular weight
      37 kDa including tags
    • Amino acids
      100 to 198

Specifications

Our Abpromise guarantee covers the use of ab117046 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP4F3_HUMAN
    • CPF3
    • CYP4F
    • Cyp4f3
    • CYPIVF3
    • Cytochrome P450 4F3
    • Cytochrome P450 LTB omega
    • Cytochrome P450, family 4, subfamily F, polypeptide 3
    • Cytochrome P450, subfamily IVF, polypeptide 3
    • Cytochrome P450, subfamily IVF, polypeptide 3 (leukotriene B4 omega hydroxylase)
    • Cytochrome P450-LTB-omega
    • Leukotriene B(4) 20 monooxygenase
    • Leukotriene B(4) omega hydroxylase
    • leukotriene B4 omega hydroxylase
    • Leukotriene-B(4) 20-monooxygenase 2
    • Leukotriene-B(4) omega-hydroxylase 2
    • leukotriene-B4 20-monooxygenase
    • LTB4 omega-hydroxylase
    • LTB4H
    see all
  • Function
    Cytochromes P450 are a group of heme-thiolate monooxygenases. This enzyme requires molecular oxygen and NADPH for the omega-hydroxylation of LTB4, a potent chemoattractant for polymorphonuclear leukocytes.
  • Tissue specificity
    Expressed in the polymorphonuclear leukocytes as well as leukocytes.
  • Pathway
    Lipid metabolism; leukotriene B4 degradation.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Recombinant Human CYP4F3 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab117046 at approximately 36.52 kDa.

References for Recombinant Human CYP4F3 protein (ab117046)

ab117046 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117046.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up