Recombinant Human Cystathionase protein (ab114582)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP32929
    • SpeciesHuman
    • SequenceMQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQG APGQHSGFEYSRSGNPTRNCLEKAVAALDGAKYCLAFASGLAATVTITHL LKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPE TKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLA LGADISMYSATKYMNGRSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPI DCYLCNRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYPGLPSHPQH ELVKRQCTGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAEL PAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHPP SGSHS
    • Molecular weight71 kDa including tags
    • Amino acids1 to 405

Specifications

Our Abpromise guarantee covers the use of ab114582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CGL_HUMAN
    • CTH
    • cystathionase (cystathionine gamma-lyase)
    • Cystathionine gamma lyase
    • Cystathionine gamma-lyase
    • Cysteine desulfhydrase
    • Gamma cystathionase
    • Gamma-cystathionase
    • Homoserine deaminase
    • Homoserine dehydratase
    • MGC9471
    see all
  • FunctionCatalyzes the last step in the transsulfuration pathway from methionine to cysteine. Has broad substrate specificity. Converts cystathionine to cysteine, ammonia and 2-oxobutanoate. Converts two cysteine molecules to lanthionine and hydrogen sulfide. Can also accept homocysteine as substrate. Specificity depends on the levels of the endogenous substrates. Generates the endogenous signaling molecule hydrogen sulfide (H2S), and so contributes to the regulation of blood pressure.
  • PathwayAmino-acid biosynthesis; L-cysteine biosynthesis; L-cysteine from L-homocysteine and L-serine: step 2/2.
  • Involvement in diseaseDefects in CTH are the cause of cystathioninuria (CSTNU) [MIM:219500]. It is an autosomal recessive phenotype characterized by abnormal accumulation of plasma cystathionine, leading to increased urinary excretion.
  • Sequence similaritiesBelongs to the trans-sulfuration enzymes family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Cystathionase protein images

  • 12.5% SDS-PAGE showing ab114582 at approximately 70.66kDa stained with Coomassie Blue.

References for Recombinant Human Cystathionase protein (ab114582)

ab114582 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"