Recombinant Human Cystatin D protein (ab151898)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GSASAQSRTLAGGIHATDLNDKSVQCALDFAISEYNKVINKDEYYSRPLQ VMAAYQQIVGGVNYYFNVKFGRTTCTKSQPNLDNCPFNDQPKLKEEEFCS FQINEVPWEDKISILNYKCRKVVDHHHHHH
    • Molecular weight
      15 kDa including tags
    • Amino acids
      21 to 142
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    ab151898 is greater than 95% pure as determined by SEC-HPLC and reducing SDS-PAGE. Lyophilized from a 0.2 µM filtered solution.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 5.50
    Constituents: 0.39% MES, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • CST 5
    • CST5
    • Cystatin 5
    • Cystatin-5
    • Cystatin-D
    • CystatinD
    • Cysteine proteinase inhibitor
    • CYTD_HUMAN
    • MGC71922
    see all
  • Function
    Cysteine proteinase inhibitor that possibly plays a protective role against proteinases present in the oral cavity. The order of preference for inhibition is cathepsin S > cathepsin H > cathepsin L > cathepsin B.
  • Tissue specificity
    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in parotid gland but not in seminal vesicle, prostate, epididymis, testis, ovary, placenta, thyroid, gastric corpus, small intestine, liver, or gall bladder tissue.
  • Sequence similarities
    Belongs to the cystatin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab151898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up