Recombinant Human Cystatin F protein (ab151365)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFL FKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLK QTLSCYSEVWVVPWLQHFEVPVLRCHVDHHHHHH
    • Molecular weight
      16 kDa including tags
    • Amino acids
      20 to 145
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names
    • CMAP
    • CST 7
    • Cst7
    • Cystatin 7
    • cystatin F (leukocystatin)
    • Cystatin like metastasis associated protein
    • Cystatin-7
    • Cystatin-F
    • Cystatin-like metastasis-associated protein
    • Cystatin7
    • CystatinF
    • CYTF_HUMAN
    • dJ568C11.1
    • Leukocystatin
    see all
  • Function
    Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
  • Tissue specificity
    Primarily expressed in peripheral blood cells and spleen.
  • Sequence similarities
    Belongs to the cystatin family.
  • Cellular localization
    Secreted. Cytoplasm.
  • Information by UniProt

References

ab151365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up