Recombinant Human Cystatin F protein (ab160077)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIG RTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
    • Amino acids
      68 to 167
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160077 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CMAP
    • CST 7
    • Cst7
    • Cystatin 7
    • cystatin F (leukocystatin)
    • Cystatin like metastasis associated protein
    • Cystatin-7
    • Cystatin-F
    • Cystatin-like metastasis-associated protein
    • Cystatin7
    • CystatinF
    • CYTF_HUMAN
    • dJ568C11.1
    • Leukocystatin
    see all
  • Function
    Inhibits papain and cathepsin L but with affinities lower than other cystatins. May play a role in immune regulation through inhibition of a unique target in the hematopoietic system.
  • Tissue specificity
    Primarily expressed in peripheral blood cells and spleen.
  • Sequence similarities
    Belongs to the cystatin family.
  • Cellular localization
    Secreted. Cytoplasm.
  • Information by UniProt

Images

  • ab160077 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160077 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160077.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up