Recombinant Human Cystatin S protein (ab116943)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP01036
    • SpeciesHuman
    • SequenceMARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF AISEYNKATEDEYYRRPLQVLRAREQTFGGVNYFFDVEVGRTICTKSQPN LDTCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEA
    • Molecular weight42 kDa including tags
    • Amino acids1 to 141

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cst4
    • Cystatin 4
    • Cystatin S precursor
    • Cystatin SA III
    • Cystatin-4
    • Cystatin-S
    • Cystatin-SA-III
    • CYTS_HUMAN
    • MGC71923
    • Salivary acidic protein 1
    see all
  • FunctionThis protein strongly inhibits papain and ficin, partially inhibits stem bromelain and bovine cathepsin C, but does not inhibit porcine cathepsin B or clostripain. Papain is inhibited non-competitively.
  • Tissue specificityExpressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
  • Sequence similaritiesBelongs to the cystatin family.
  • Post-translational
    modifications
    Phosphorylated at both its N- and C-terminal regions.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Cystatin S protein images

  • 12.5% SDS-PAGE gel showing ab116943 at approximately41.58kDa stained with Coomassie Blue.

References for Recombinant Human Cystatin S protein (ab116943)

ab116943 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"