Recombinant Human Cystatin S protein (ab116943)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF AISEYNKATEDEYYRRPLQVLRAREQTFGGVNYFFDVEVGRTICTKSQPN LDTCAFHEQPELQKKQLCSFEIYEVPWEDRMSLVNSRCQEA
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 141

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116943 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cst4
    • Cystatin 4
    • Cystatin S precursor
    • Cystatin SA III
    • Cystatin-4
    • Cystatin-S
    • Cystatin-SA-III
    • CYTS_HUMAN
    • MGC71923
    • Salivary acidic protein 1
    see all
  • Function
    This protein strongly inhibits papain and ficin, partially inhibits stem bromelain and bovine cathepsin C, but does not inhibit porcine cathepsin B or clostripain. Papain is inhibited non-competitively.
  • Tissue specificity
    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
  • Sequence similarities
    Belongs to the cystatin family.
  • Post-translational
    modifications
    Phosphorylated at both its N- and C-terminal regions.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE gel showing ab116943 at approximately41.58kDa stained with Coomassie Blue.

References

ab116943 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116943.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up