Recombinant human Cystatin SA/CST2 protein (ab180061)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Tags: His tag C-Terminus
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant human Cystatin SA/CST2 protein
See all Cystatin SA/CST2 proteins and peptides -
Biological activity
Measured by its ability to inhibit active Cathepsin L cleavage of a fluorogenic peptide substrate Z-LR-AMC. The IC50 value is < 10.0 nM.
-
Purity
> 95 % SDS-PAGE. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
WSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF QIYEVPWEDRMSLVNSRCQEA -
Predicted molecular weight
15 kDa including tags -
Amino acids
21 to 141 -
Tags
His tag C-Terminus -
Additional sequence information
(AAH62679)
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab180061 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at 4°C (stable for up to 12 months). Store at -80°C. Avoid freeze / thaw cycle. For long term storage it is recommended to add a carrier protein on reconstitution (0.1% HSA or BSA).
pH: 7.4
Constituents: 5% Trehalose, 0.3% Tris, 0.88% Sodium chloride
Lyophilized from 0.22 µm filtered solution.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionIt is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 ug/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing.
General Info
-
Alternative names
- CST 2
- CST2
- Cystatin 2
see all -
Function
Thiol protease inhibitor. -
Tissue specificity
Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in submandibular gland and parotid gland. -
Sequence similarities
Belongs to the cystatin family. -
Cellular localization
Secreted. - Information by UniProt
Images
-
Human Cystatin SA (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
-
SDS-PAGE analysis of ab180061 in reducing conditions. Gel stained overnight with Coomassie Blue. DTT-reduced protein migrates as 15-17 kDa.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab180061 has not yet been referenced specifically in any publications.