Recombinant Human Cystatin SN protein (ab116170)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMWSPKEEDRIIPGGIYNADLNDEWVQR ALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTK SQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKS RCQES
    • Molecular weight
      17 kDa including tags
    • Amino acids
      21 to 141
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab116170 is purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 10% Glycerol, 0.58% Sodium chloride, 0.32% Tris HCl, 0.03% DTT

General Info

  • Alternative names
    • CST1
    • Cystain SAI
    • Cystain-SA-I
    • Cystatin 1
    • Cystatin-1
    • Cystatin-SN
    • Cystatin1
    • Cysteine proteinase inhibitor, type 2 family
    • CYTN
    • CYTN_HUMAN
    • Salivary cystatin SA1
    • Salivary cystatin-SA-1
    see all
  • Function
    Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to cystatin S but that differ in their specificity due to amino acid sequence differences. Cystatin SN, with a pI of 7.5, is a much better inhibitor of papain and dipeptidyl peptidase I than is cystatin S, although both inhibit ficin equally well.
  • Tissue specificity
    Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
  • Sequence similarities
    Belongs to the cystatin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human Cystatin SN protein images

  • 15% SDS-PAGE showing ab116170 at approximately 16.9kDa (3µg).

References for Recombinant Human Cystatin SN protein (ab116170)

ab116170 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up