Recombinant Human Cytochrome b5 protein (ab88106)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEV LREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPEP

Specifications

Our Abpromise guarantee covers the use of ab88106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    purified by affinity chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • CYB 5
    • CYB 5A
    • CYB5
    • CYB5_HUMAN
    • Cyb5a
    • Cytochrome b 5
    • Cytochrome b5
    • Cytochrome b5 (microsomal)
    • Cytochrome b5 type A
    • Cytochrome b5 type A (microsomal)
    • MCB 5
    • MCB5
    • Microsomal cytochrome b5
    • Microsomal cytochrome b5 type A
    • Type 1 cyt b5
    see all
  • FunctionCytochrome b5 is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases.
  • Involvement in diseaseDefects in CYB5A are the cause of methemoglobinemia CYB5A-related (METHB-CYB5A) [MIM:250790]. A form of methemoglobinemia, a hematologic disease characterized by the presence of excessive amounts of methemoglobin in blood cells, resulting in decreased oxygen carrying capacity of the blood, cyanosis and hypoxia.
  • Sequence similaritiesBelongs to the cytochrome b5 family.
    Contains 1 cytochrome b5 heme-binding domain.
  • Cellular localizationCytoplasm and Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

References for Recombinant Human Cytochrome b5 protein (ab88106)

ab88106 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"