Recombinant Human Cytochrome P450 17A1 protein (ab152320)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MWELVALLLLTLAYLFWPKRRCPGAKYPKSLLSLPLVGSLPFLPRHGHMH NNFFKLQKKYGPIYSVRMGTKTTVIVGHHQLAKEVLIKKGKDFSGRPQMA TLDIASNNRKGIAFADSGAHWQLHRRLAMATFALFKDGDQKLEKIICQEI STLCDMLATHNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQN YNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENY KEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIF GAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRL LLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALH HNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQ ELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWR EAQAEGST
    • Molecular weight
      82 kDa including tags
    • Amino acids
      1 to 508

Specifications

Our Abpromise guarantee covers the use of ab152320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 20 lyase
    • CP17A_HUMAN
    • CPT7
    • CYP17
    • CYP17A1
    • CYPXVII
    • Cytochrome P450 17A1
    • Cytochrome P450 family 17
    • Cytochrome P450 family 17 subfamily A polypeptide 1
    • Cytochrome p450 subfamily XVII (steroid 17 alpha hydroxylase) adrenal hyperplasia
    • Cytochrome p450 XVIIA1
    • Cytochrome P450-C17
    • Cytochrome P450c17
    • OTTHUMP00000020382
    • P450 C17
    • P450c17
    • S17AH
    • Steroid 17 alpha hydroxylase/17,20 lyase
    • Steroid 17 alpha monooxygenase
    • Steroid 17-alpha-hydroxylase/17
    • Steroid 17-alpha-monooxygenase
    see all
  • Function
    Conversion of pregnenolone and progesterone to their 17-alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty.
  • Pathway
    Lipid metabolism; steroid biosynthesis.
  • Involvement in disease
    Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) [MIM:202110]. AH5 is a form of congenital adrenal hyperplasia, a common recessive disease due to defective synthesis of cortisol. Congenital adrenal hyperplasia is characterized by androgen excess leading to ambiguous genitalia in affected females, rapid somatic growth during childhood in both sexes with premature closure of the epiphyses and short adult stature. Four clinical types: "salt wasting" (SW, the most severe type), "simple virilizing" (SV, less severely affected patients), with normal aldosterone biosynthesis, "non-classic form" or late onset (NC or LOAH), and "cryptic" (asymptomatic).
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Post-translational
    modifications
    Phosphorylation is necessary for 17,20-lyase, but not for 17-alpha-hydroxylase activity.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152320 stained with Coomassie Blue.

References

ab152320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up