Recombinant Human Cytochrome P450 26B protein (ab153422)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLFEGLDLVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIP KGSMGFPLIGETGHWLLQGSGFQSSRREKYGNVFKTHLLGRPLIRVTGAE NVRKILMGEHHLVSTEWPRSTRMLLGPNTVSNSIGDIHRNKRKVFSKIFS HEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGF SIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQARQILQKGLEKA IREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYAT TASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSG LRYLDCVIKEVMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTH DTAPVFKDVNVFDPDRFSQARSEDKDGRFHYLPFGGGVRTCLGKHLAKLF LKVLAVELASTSRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEI LPETEAMLSATV
    • Amino acids
      1 to 512
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CP26
    • CP26B_HUMAN
    • CYP26A2
    • cyp26b1
    • Cytochrome P450 26A2
    • Cytochrome P450 26B1
    • Cytochrome P450 family 26 subfamily B polypeptide 1
    • Cytochrome P450 retinoic acid-inactivating 2
    • Cytochrome P450 retinoid metabolizing protein
    • Cytochrome P450 subfamily XXVIA, polypeptide 2
    • Cytochrome P450 subfamily XXVIB polypeptide 1
    • Cytochrome P450RAI-2
    • DKFZp686G0638
    • dol
    • EC 1.14.
    • fc21d03
    • MGC129613
    • P450 26A2
    • P450 retinoic acid inactivating 2
    • P450RAI 2
    • P450RAI2
    • Retinoic acid metabolizing cytochrome
    • Retinoic acid-metabolizing cytochrome
    • RHFCA
    • stocksteif
    • wu:fc21d03
    • wu:fc26h10
    • zgc:76999
    see all
  • Function
    Involved in the metabolism of retinoic acid (RA), rendering this classical morphogen inactive through oxidation. Involved in the specific inactivation of all-trans-retinoic acid (all-trans-RA), with a preference for the following substrates: all-trans-RA > 9-cis-RA > 13-cis-RA. Generates several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA, and 18-OH-RA. Esential for postnatal survival. Plays a central role in germ cell development: acts by degrading RA in the developing testis, preventing STRA8 expression, thereby leading to delay of meiosis. Required for the maintenance of the undifferentiated state of male germ cells during embryonic development in Sertoli cells, inducing arrest in G0 phase of the cell cycle and preventing meiotic entry. Plays a role in skeletal development, both at the level of patterning and in the ossification of bone and the establishment of some synovial joints.
  • Tissue specificity
    Highly expressed in brain, particularly in the cerebellum and pons.
  • Involvement in disease
    Radiohumeral fusions with other skeletal and craniofacial anomalies
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab153422 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up