Recombinant Human Cytochrome P450 2A6 protein (ab114776)

Overview

  • Product nameRecombinant Human Cytochrome P450 2A6 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP11509
    • SpeciesHuman
    • SequenceLGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGL ARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR
    • Molecular weight37 kDa including tags
    • Amino acids395 to 494

Specifications

Our Abpromise guarantee covers the use of ab114776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Coumarin 7 hydroxylase
    • Coumarin 7-hydroxylase
    • CP2A6_HUMAN
    • CPA6
    • CYP2A
    • CYP2A3
    • CYP2A6
    • CYPIIA6
    • Cytochrome P450 2A6
    • Cytochrome P450 IIA3
    • Cytochrome P450 subfamily IIA (phenobarbital inducible) polypeptide 6
    • Cytochrome P450(I)
    • Cytochrome P450, family 2 subfamily A polypeptide 6
    • Flavoprotein linked monooxygenase
    • P450C2A
    • P450PB
    • Xenobiotic monooxygenase
    see all
  • FunctionExhibits a high coumarin 7-hydroxylase activity. Can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. Competent in the metabolic activation of aflatoxin B1. Constitutes the major nicotine C-oxidase. Possesses low phenacetin O-deethylation activity.
  • Tissue specificityLiver.
  • Sequence similaritiesBelongs to the cytochrome P450 family.
  • Cellular localizationEndoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Recombinant Human Cytochrome P450 2A6 protein images

  • ab114776 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Cytochrome P450 2A6 protein (ab114776)

ab114776 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"