Recombinant Human Cytochrome P450 2A6 protein (ab114776)

Overview

  • Product name
    Recombinant Human Cytochrome P450 2A6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LGSVLRDPSFFSNPQDFNPQHFLNEKGQFKKSDAFVPFSIGKRNCFGEGL ARMELFLFFTTVMQNFRLKSSQSPKDIDVSPKHVGFATIPRNYTMSFLPR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      395 to 494

Specifications

Our Abpromise guarantee covers the use of ab114776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Coumarin 7 hydroxylase
    • Coumarin 7-hydroxylase
    • CP2A6_HUMAN
    • CPA6
    • CYP2A
    • CYP2A3
    • CYP2A6
    • CYPIIA6
    • Cytochrome P450 2A6
    • Cytochrome P450 IIA3
    • Cytochrome P450 subfamily IIA (phenobarbital inducible) polypeptide 6
    • Cytochrome P450(I)
    • Cytochrome P450, family 2 subfamily A polypeptide 6
    • Flavoprotein linked monooxygenase
    • P450C2A
    • P450PB
    • Xenobiotic monooxygenase
    see all
  • Function
    Exhibits a high coumarin 7-hydroxylase activity. Can act in the hydroxylation of the anti-cancer drugs cyclophosphamide and ifosphamide. Competent in the metabolic activation of aflatoxin B1. Constitutes the major nicotine C-oxidase. Possesses low phenacetin O-deethylation activity.
  • Tissue specificity
    Liver.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • ab114776 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up