Recombinant Human Cytochrome P450 2B6 protein (ab114648)

Overview

  • Product nameRecombinant Human Cytochrome P450 2B6 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20813
    • SpeciesHuman
    • SequenceMELSVLLFLALLTGLLLLLVQRHPNTHDRLPPGPRPLPLLGNLLQMDRRG LLKSFLRFREKYGDVFTVHLGPRPVVMLCGVEAIREALVDKAEAFSGRGK IAMVDPFFRGYGVIFANGNRWKVLRRFSVTTMRDFGMGKRSVEERIQEEA QCLIEELRKSKGALMDPTFLFQSITANIICSIVFGKRFHYQDQEFLKMLN LFYQTFSLISSVFGQLFELFSGFLTYFPGAHRQVYKNLQEINAYIGHSVE KHRETLDPSAPKDLIDTYLLHMEEEKSNAHSEFSHQNLNLNTLSLFFAGT ETTSTTLRYGFLLMLKYPHVAERVYREIEQVIGPHRPPELHDRAKMPYTE AVIYEIQRFSDLLPMGVPHIVTQHTSFRGYIIPKDTEVFLILSTALHDPH YFEKPDAFNPDHFLDANGALKKTEAFIPFSLGKRICLGEGIARAELFLFF TTILQNFSMASPVAPEDIDLTPQECGVGKIPPTYQIRFLPR
    • Molecular weight80 kDa including tags
    • Amino acids1 to 491

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114648 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1,4 cineole 2 exo monooxygenase
    • 11B1
    • CP2B6_HUMAN
    • CPB 6
    • CPB6
    • CYP 2B6
    • CYP IIB6
    • CYP2B
    • CYP2B6
    • CYP2B7
    • CYP2B7P
    • CYPIIB6
    • Cytochrome P450 2B6
    • Cytochrome P450 family 2 subfamily B
    • Cytochrome P450 family 2 subfamily B polypeptide 6
    • Cytochrome P450 IIB1
    • Cytochrome P450 phenobarbital inducible
    • Cytochrome P450 subfamily IIB (phenobarbital inducible)
    • Cytochrome P450 subfamily IIB (phenobarbital inducible) polypeptide 6
    • Cytochrome P450 subfamily IIB polypeptide 6
    • EFVM
    • IIB1
    • P450
    • P450 IIB1
    • P450IIB1
    see all
  • FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Tissue specificityExpressed in liver, lung and heart right ventricle.
  • Sequence similaritiesBelongs to the cytochrome P450 family.
  • Post-translational
    modifications
    Phosphorylation is accompanied by a decrease in enzyme activity.
  • Cellular localizationEndoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Recombinant Human Cytochrome P450 2B6 protein images

  • ab114648 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Cytochrome P450 2B6 protein (ab114648)

ab114648 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114648.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"