Recombinant Human Cytochrome P450 2D6 protein (ab152317)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLR NLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLT
    • Molecular weight
      37 kDa including tags
    • Amino acids
      91 to 190

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CPD6
    • CYP2D
    • CYP2D6
    • CYP2D7AP
    • CYP2D7BP
    • CYP2D7P2
    • CYP2D8P2
    • CYP2DL1
    • CYPIID6
    • Cytochrome P450 DB1
    • Cytochrome P450 family 2 subfamily D member 6
    • Cytochrome P450 family 2 subfamily D polypeptide 6
    • Debrisoquine 4 hydroxylase
    • Flavoprotein linked monooxygenase
    • Microsomal monooxygenase
    • P450 DB1
    • P450C2D
    • P450DB1
    • Xenobiotic monooxygenase
    see all
  • Relevance
    Cytochrome P450 2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. Cytochrome P450 2D6 is the molecular target of autoantibodies against the "liver kidney microsomal antigen 1" (LKM 1).
  • Cellular localization
    Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.

Images

  • 12.5% SDS-PAGE analysis of ab152317 stained with Coomassie Blue.

References

ab152317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up