Recombinant Human Cytochrome P450 3A4 protein (ab114328)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08684
    • SpeciesHuman
    • SequenceDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMK LALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESRDGTVSGA
    • Molecular weight37 kDa including tags
    • Amino acids404 to 503

Specifications

Our Abpromise guarantee covers the use of ab114328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1,8-cineole 2-exo-monooxygenase
    • Albendazole monooxygenase
    • Albendazole sulfoxidase
    • CP33
    • CP34
    • CP3A4_HUMAN
    • CYP3
    • CYP3A
    • CYP3A3
    • CYP3A4
    • CYPIIIA3
    • CYPIIIA4
    • Cytochrome P450 3A3
    • Cytochrome P450 3A4
    • Cytochrome P450 family 3 subfamily A polypeptide 4
    • Cytochrome P450 HLp
    • Cytochrome P450 NF-25
    • Cytochrome P450 subfamily IIIA polypeptide 4
    • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 3
    • cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4
    • Cytochrome P450-PCN1
    • Glucocorticoid inducible P450
    • HLP
    • MGC126680
    • NF 25
    • NF25
    • Nifedipine oxidase
    • P450 III steroid inducible
    • P450 PCN1
    • P450, family III
    • P450C3
    • P450PCN1
    • Quinine 3 monooxygenase
    • Quinine 3-monooxygenase
    • Taurochenodeoxycholate 6 alpha hydroxylase
    • Taurochenodeoxycholate 6-alpha-hydroxylase
    see all
  • FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It performs a variety of oxidation reactions (e.g. caffeine 8-oxidation, omeprazole sulphoxidation, midazolam 1'-hydroxylation and midazolam 4-hydroxylation) of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. The enzyme also hydroxylates etoposide.
  • Tissue specificityExpressed in prostate and liver. According to some authors, it is not expressed in brain (PubMed:19094056). According to others, weak levels of expression are measured in some brain locations (PubMed:19359404 and PubMed:18545703). Also expressed in epithelium of the small intestine and large intestine, bile duct, nasal mucosa, kidney, adrenal cortex, epithelium of the gastric mucosa with intestinal metaplasia, gallbladder, intercalated ducts of the pancreas, chief cells of the parathyroid and the corpus luteum of the ovary (at protein level).
  • Sequence similaritiesBelongs to the cytochrome P450 family.
  • Post-translational
    modifications
    Polyubiquitinated in the presence of AMFR and UBE2G1 and also STUB1/CHIP and UBE2D1 (in vitro).
  • Cellular localizationEndoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Recombinant Human Cytochrome P450 3A4 protein images

  • ab114328 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Cytochrome P450 3A4 protein (ab114328)

ab114328 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"