Recombinant Human Cytochrome P450 3A5 protein (ab114670)

Overview

  • Product name
    Recombinant Human Cytochrome P450 3A5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDLIPNLAVETWLLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNV LSYRQGLWKFDTECYKKYGKMWGTYEGQLPVLAITDPDVIRTVLVKECYS VFTNRRSLGPVGFMKSAISLAEDEEWKRIRSLLSPTFTSGKLKEMFPIIA QYGDVLVRNLRREAEKGKPVTLKDIFGAYSMDVITGTSFGVNIDSLNNPQ DPFVESTKKFLKFGFLDPLFLSIILFPFLTPVFEALNVSLFPKDTINFLS KSVNRMKKSRLNDKQKHRLDFLQLMIDSQNSKETESHKALSDLELAAQSI IFIFAGYETTSSVLSFTLYELATHPDVQQKLQKEIDAVLPNKAPPTYDAV VQMEYLDMVVNETLRLFPVAIRLERTCKKDVEINGVFIPKGSMVVIPTYA LHHDPKYWTEPEEFRPERFSKKKDSIDPYIYTPFGTGPRNCIGMRFALMN MKLALIRVLQNFSFKPCKETQIPLKLDTQGLLQPEKPIVLKVDSRDGTLS GE
    • Molecular weight
      81 kDa including tags
    • Amino acids
      1 to 502

Specifications

Our Abpromise guarantee covers the use of ab114670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Aryl hydrocarbon hydroxylase
    • CP35
    • CP3A5_HUMAN
    • CYP3A5
    • CYPIIIA5
    • Cytochrome P450
    • Cytochrome P450 3A5
    • Cytochrome P450 family 3 subfamily A polypeptide 5
    • Cytochrome P450 HLp2
    • Cytochrome P450 subfamily IIIA (niphedipine oxidase) polypeptide 5
    • Cytochrome P450-PCN3
    • DKFZp686L16231
    • Flavoprotein linked monooxygenase
    • FLJ31317
    • HLp2
    • Microsomal monooxygenase
    • Niphedipine oxidase
    • P450PCN3
    • PCN3
    • Xenobiotic monooxygenase
    see all
  • Function
    Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab114670 on a 12.5% gel stained with Coomassie Blue.

References

ab114670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up