Recombinant Human Cytochrome P450 4A11/22 protein (ab114572)

Overview

  • Product nameRecombinant Human Cytochrome P450 4A11/22 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ02928
    • SpeciesHuman
    • SequenceMSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQ SPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLY DPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAF HYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKC AFRHWQRAQHSRHLP
    • Molecular weight50 kDa
    • Amino acids1 to 216

Specifications

Our Abpromise guarantee covers the use of ab114572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 20-HETE synthase
    • 20-hydroxyeicosatetraenoic acid synthase
    • CP4AB_HUMAN
    • CYP4A11
    • CYP4AII
    • CYPIVA11
    • Cytochrome P-450HK-omega
    • Cytochrome P450 4A11
    • Cytochrome P450HL-omega
    • Fatty acid omega-hydroxylase
    • Lauric acid omega-hydroxylase
    • OMEGA-HYDROXYLASE, FATTY ACID
    see all
  • FunctionCatalyzes the omega- and (omega-1)-hydroxylation of various fatty acids such as laurate, myristate and palmitate. Has little activity toward prostaglandins A1 and E1. Oxidizes arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE).
  • Tissue specificityKidney and liver.
  • Sequence similaritiesBelongs to the cytochrome P450 family.
  • Cellular localizationEndoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Recombinant Human Cytochrome P450 4A11/22 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References for Recombinant Human Cytochrome P450 4A11/22 protein (ab114572)

ab114572 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"