Recombinant Human Cytochrome P450 4A11/22 protein (ab114572)

Overview

  • Product name
    Recombinant Human Cytochrome P450 4A11/22 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQ SPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLY DPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAF HYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKC AFRHWQRAQHSRHLP
    • Molecular weight
      50 kDa
    • Amino acids
      1 to 216

Specifications

Our Abpromise guarantee covers the use of ab114572 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 20-HETE synthase
    • 20-hydroxyeicosatetraenoic acid synthase
    • CP4AB_HUMAN
    • CYP4A11
    • CYP4AII
    • CYPIVA11
    • Cytochrome P-450HK-omega
    • Cytochrome P450 4A11
    • Cytochrome P450HL-omega
    • Fatty acid omega-hydroxylase
    • Lauric acid omega-hydroxylase
    • OMEGA-HYDROXYLASE, FATTY ACID
    see all
  • Function
    Catalyzes the omega- and (omega-1)-hydroxylation of various fatty acids such as laurate, myristate and palmitate. Has little activity toward prostaglandins A1 and E1. Oxidizes arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE).
  • Tissue specificity
    Kidney and liver.
  • Sequence similarities
    Belongs to the cytochrome P450 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Microsome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue

References

ab114572 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114572.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up