Recombinant Human Cytochrome P450 Reductase protein (ab112344)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP16435
    • SpeciesHuman
    • SequenceMINMGDSHVDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKK KEEVPEFTKIQTLTSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANR LSKDAHRYGMRGMSADPEEYDLADLSSLPEIDNALVVFCMATYGEGDPTD NAQDFYDWLQETDVDLSGVKFAVFGLGNKTYEHFNAMGKYVDKRLEQLGA QRIFELGLGDDDGNLEEDFITWREQFWLAVCEHFGVEATGEESSIRQYEL VVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE RHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMS LNNLDEESNKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPS EQELLRKMASSSGEGKELYLSWVVEARRHILAILQDCPSLRPPIDHLCEL LPRLQARYYSIASSSKVHPNSVHICAVVVEYETKAGRINKGVATNWLRAK EPVGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGVAPFIGFIQER AWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHRDGALTQLNVAFSR EQSHKVYVQHLLKQDREHLWKLIEGGAHIYVCGDARNMARDVQNTFYDIV AELGAMEHAQAVDYIKKLMTKGRYSLDVWS
    • Molecular weight101 kDa including tags
    • Amino acids1 to 680
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityuseful for Antibody Production and Protein Array
  • Applications

    SDS-PAGE

  • FormLiquid
  • Additional notesuseful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl
    Note: Glutathione is reduced

General Info

  • Alternative names
    • CPR
    • CYPOR
    • DKFZp686G04235
    • FLJ26468
    • NADPH Cytochrome P450 Reductase
    • NADPH dependent cytochrome P450 reductase
    • NADPH--cytochrome P450 reductase
    • NCPR_HUMAN
    • P450 (cytochrome) oxidoreductase
    • P450 Cytochrome Oxidoreductase
    • P450R
    • por
    see all
  • FunctionThis enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.
  • Involvement in diseaseDefects in POR are the cause of adrenal hyperplasia variant type (AHV) [MIM:201750]; also known as Antley-Bixler syndrome-like phenotype with disordered steroidogenesis. AHV is a rare variant of congenital adrenal hyperplasia. It is an autosomal recessive disorder with apparent combined P450C17 and P450C21 deficiency. Affected girls are born with ambiguous genitalia, but their circulating androgens are low and virilization does not progress. Conversely, affected boys are sometimes born undermasculinized. Boys and girls can also present with bone malformations, in some cases resembling the pattern seen in patients with Antley-Bixler syndrome.
    Defects in POR are a cause of isolated disordered steroidogenesis (IDS) [MIM:201750].
  • Sequence similaritiesIn the C-terminal section; belongs to the flavoprotein pyridine nucleotide cytochrome reductase family.
    Contains 1 FAD-binding FR-type domain.
    Contains 1 flavodoxin-like domain.
  • Cellular localizationEndoplasmic reticulum membrane. Anchored to the ER membrane by its N-terminal hydrophobic region.
  • Information by UniProt

Recombinant Human Cytochrome P450 Reductase protein images

  • 12.5% SDS-PAGE showing ab112344 at approximately 100.87kDa stained with Coomassie Blue.

References for Recombinant Human Cytochrome P450 Reductase protein (ab112344)

ab112344 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112344.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"