Recombinant Human Cytoglobin protein (ab97347)

Overview

  • Product name
    Recombinant Human Cytoglobin protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMEKVPGEMEIERRERSEELSEAERKAVQAM WARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRK HACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGV ILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT PPATLPSSGP
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 190
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab97347 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Cygb
    • CYGB_HUMAN
    • Cytoglobin
    • Hgb
    • Histoglobin
    • STAP
    • Stellate cell activation associated protein
    • Stellate cell activation-associated protein
    see all
  • Function
    May have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.
  • Tissue specificity
    Ubiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
  • Sequence similarities
    Belongs to the globin family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab97347 at approximately 23.5kDa (3µg).

References

ab97347 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab97347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up