Recombinant Human Cytoglobin protein (ab97347)

Overview

  • Product nameRecombinant Human Cytoglobin protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8WWM9
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEKVPGEMEIERRERSEELSEAERKAVQAM WARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPLEMERSPQLRK HACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGV ILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATT PPATLPSSGP
    • Molecular weight24 kDa including tags
    • Amino acids1 to 190
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab97347 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF-TOF
  • Purity> 90 % SDS-PAGE.
    ab97347 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Cygb
    • CYGB_HUMAN
    • Cytoglobin
    • Hgb
    • Histoglobin
    • STAP
    • Stellate cell activation associated protein
    • Stellate cell activation-associated protein
    see all
  • FunctionMay have a protective function during conditions of oxidative stress. May be involved in intracellular oxygen storage or transfer.
  • Tissue specificityUbiquitously expressed. Highest expression in heart, stomach, bladder and small intestine.
  • Sequence similaritiesBelongs to the globin family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Cytoglobin protein images

  • 15% SDS-PAGE showing ab97347 at approximately 23.5kDa (3µg).

References for Recombinant Human Cytoglobin protein (ab97347)

ab97347 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab97347.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"