Recombinant Human Cytohesin 1 protein (ab160406)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIEN LGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQF LYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLW SFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSL HNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDD GNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEG NHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
    • Amino acids
      1 to 398
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B2 1
    • CLM1
    • CTH 1
    • CYH1_HUMAN
    • CYTH1
    • CYTIP
    • Cytoadhesin 1
    • CYTOHESIN 1
    • Cytohesin-1
    • D17S811E
    • FLJ34050
    • FLJ41900
    • Homolog of secretory protein SEC7
    • KIAA4240
    • mKIAA4240
    • mSec7 1
    • OTTHUMP00000196778
    • OTTHUMP00000196779
    • PH
    • PH, SEC7 and coiled-coil domain containing protein 1
    • Pleckstrin homology Sec7 and coiled/coil domains 1
    • Pleckstrin homology Sec7 and coiled/coil domains protein 1
    • Pleckstrin homology, Sec7 and coiled coil domains 1
    • PSCD1
    • Sec7
    • SEC7 and coiled-coil domain-containing protein 1
    • SEC7 homolog A
    • SEC7 homolog B2 1
    • SEC7 homolog B2-1
    • SEC7, yeast, homolog of
    • Sec7a
    see all
  • Function
    Promotes guanine-nucleotide exchange on ARF1 and ARF5. Promotes the activation of ARF through replacement of GDP with GTP.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 PH domain.
    Contains 1 SEC7 domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab160406 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160406 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up