Recombinant Human Cytohesin 3 protein (ab160405)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMT EIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPED VAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALR QFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIML NTSLHNHNVRDKPTAERFIAMNRGINEGGDLPEELLRNLYESIKNEPFKI PEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTT DKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRV VEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
    • Amino acids
      1 to 399
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CYTH3
    • ARF nucleotide-binding site opener 3
    • ARNO3
    • ARNO3 protein
    • CYH3_HUMAN
    • Cyth3
    • Cytohesin-3
    • General receptor of phosphoinositides 1
    • Grp1
    • PH
    • PH, SEC7 and coiled-coil domain-containing protein 3
    • Protein ARNO3
    • PSCD3
    • SEC7 and coiled-coil domain-containing protein 3
    • SEC7 homolog C
    • Sec7-3
    • Sec7c
    see all
  • Function
    Promotes guanine-nucleotide exchange on ARF1. Promotes the activation of ARF through replacement of GDP with GTP.
  • Tissue specificity
    Almost absent from liver, thymus and peripheral blood lymphocytes.
  • Sequence similarities
    Contains 1 PH domain.
    Contains 1 SEC7 domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab160405 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160405 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up