Recombinant Human Cytokeratin 13 protein (ab114326)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP13646
    • SpeciesHuman
    • SequenceVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEV STNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYA
    • Molecular weight37 kDa
    • Amino acids258 to 357

Specifications

Our Abpromise guarantee covers the use of ab114326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 47 kDa cytokeratin
    • CK-13
    • CK13
    • Cytokeratin 13
    • Cytokeratin-13
    • K13
    • K1C13_HUMAN
    • Ka13
    • Keratin
    • Keratin 13
    • keratin type I cytoskeletal 13
    • Keratin-13
    • Krt-1.13
    • Krt1-13
    • KRT13
    • MGC161462
    • MGC3781
    • type I cytoskeletal 13
    • Type I keratin Ka13
    • WSN2
    see all
  • Tissue specificityExpressed in some epidermal sweat gland ducts (at protein level) and in exocervix, esophagus and placenta.
  • Involvement in diseaseDefects in KRT13 are a cause of white sponge nevus of cannon (WSN) [MIM:193900]. WSN is a rare autosomal dominant disorder which predominantly affects non-cornified stratified squamous epithelia. Clinically, it is characterized by the presence of soft, white, and spongy plaques in the oral mucosa. The characteristic histopathologic features are epithelial thickening, parakeratosis, and vacuolization of the suprabasal layer of oral epithelial keratinocytes. Less frequently the mucous membranes of the nose, esophagus, genitalia and rectum are involved.
  • Sequence similaritiesBelongs to the intermediate filament family.
  • Post-translational
    modifications
    O-glycosylated; glycans consist of single N-acetylglucosamine residues.
  • Information by UniProt

Recombinant Human Cytokeratin 13 protein images

  • SDS-PAGE analysis of ab114326 on a 12.5% gel stained with Coomassie Blue.

References for Recombinant Human Cytokeratin 13 protein (ab114326)

ab114326 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"