Recombinant Human Cytokeratin 15 protein (ab158804)

Overview

  • Product name
    Recombinant Human Cytokeratin 15 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSAR FVSSGSGGGYGGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGL LSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDWYQKQTPTSPE CDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELA LRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYLKKNHEEEMKE FSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSK TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSL AETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLE QEIATYRSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVS SHKREI
    • Amino acids
      1 to 456
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158804 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI528832
    • CK 15
    • CK-15
    • CK15
    • Cytokeratin-15
    • Cytokeratin15
    • K15
    • K1C15_HUMAN
    • K1CO
    • Ka15
    • Keratin
    • Keratin 15
    • Keratin 15 basic
    • Keratin 15 beta
    • Keratin complex 1 acidic gene 15
    • Keratin type I cytoskeletal 15
    • Keratin-15
    • Keratin15
    • KRT 15
    • Krt1-15
    • KRT15
    • KRTB
    • KRTL15
    • Type I cytoskeletal 15
    • Type I keratin Ka15
    see all
  • Tissue specificity
    Expressed in a discontinuous manner in the basal cell layer of adult skin epidermis, but continuously in the basal layer of fetal skin epidermis and nail. Also expressed in the outer root sheath above the hair bulb in hair follicle (at protein level). Expressed homogeneously in all cell layers of the esophagus and exocervix, but detected in the basal cell layer only of oral mucosa, skin and in the basal plus the next two layers of the suprabasal epithelium of the palate.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • ab158804 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158804 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158804.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up