Recombinant Human Cytokeratin 16 protein (ab114405)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP08779
    • SpeciesHuman
    • SequenceRRDAETWFLSKTEELNKEVASNSELVQSSRSEVTELRRVLQGLEIELQSQ LSMKASLENSLEETKGRYCMQLSQIQGLIGSVEEQLAQLRCEMEQQSQ
    • Molecular weight36 kDa including tags
    • Amino acids301 to 398

Specifications

Our Abpromise guarantee covers the use of ab114405 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CK 16
    • CK-16
    • CK16
    • Cytokeratin-16
    • Cytokeratin16
    • FNEPPK
    • Focal non epidermolytic palmoplantar keratoderma
    • K 16
    • K16
    • K1C16_HUMAN
    • K1CP
    • Keratin
    • Keratin 1 type I
    • Keratin 16
    • Keratin type I cytoskeletal 16
    • Keratin-16
    • Keratin16
    • KRT 16
    • Krt16
    • KRT16A
    • NEPPK
    • PC1
    • type I cytoskeletal 16
    see all
  • Tissue specificityExpressed in the hair follicle, nail bed and in mucosal stratified squamous epithelia and, suprabasally, in oral epithelium and palmoplantar epidermis. Also found in luminal cells of sweat and mammary gland ducts.
  • Involvement in diseaseDefects in KRT16 are a cause of pachyonychia congenita type 1 (PC1) [MIM:167200]; also known as Jadassohn-Lewandowsky syndrome. PC1 is an autosomal dominant ectodermal dysplasia characterized by hypertrophic nail dystrophy resulting in onchyogryposis (thickening and increase in curvature of the nail), palmoplantar keratoderma, follicular hyperkeratosis, and oral leukokeratosis. Hyperhidrosis of the hands and feet is usually present.
    Defects in KRT16 are the cause of palmoplantar keratoderma non-epidermolytic focal (FNEPPK) [MIM:613000]. A dermatological disorder characterized by non-epidermolytic palmoplantar keratoderma limited to the pressure points on the balls of the feet, with later mild involvement on the palms. Oral, genital and follicular keratotic lesions are often present.
    Defects in KRT16 are a cause of unilateral palmoplantar verrucous nevus (UPVN) [MIM:144200]. UPVN is characterized by a localized thickening of the skin in parts of the right palm and the right sole.
    Note=KRT16 and KRT17 are coexpressed only in pathological situations such as metaplasias and carcinomas of the uterine cervix and in psoriasis vulgaris.
  • Sequence similaritiesBelongs to the intermediate filament family.
  • Information by UniProt

Recombinant Human Cytokeratin 16 protein images

  • 12.5% SDS-PAGE analysis of ab114405, stained with Coomassie Blue.

References for Recombinant Human Cytokeratin 16 protein (ab114405)

ab114405 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114405.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"