Recombinant Human Cytokeratin 3 protein (ab114414)

Overview

  • Product name
    Recombinant Human Cytokeratin 3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMED LVEDFKKK
    • Molecular weight
      32 kDa including tags
    • Amino acids
      232 to 289

Specifications

Our Abpromise guarantee covers the use of ab114414 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 65 kDa cytokeratin
    • CK-3
    • CK3
    • Cytokeratin-3
    • K2C3_HUMAN
    • K3
    • Keratin
    • Keratin 3
    • Keratin type II cytoskeletal 3
    • Keratin-3
    • KRT3
    • type II cytoskeletal 3
    • Type-II keratin Kb3
    see all
  • Tissue specificity
    Cornea specific.
  • Involvement in disease
    Defects in KRT3 are a cause of Meesmann corneal dystrophy (MECD) [MIM:122100]; also abbreviated as MCD and known as juvenile epithelial corneal dystrophy of Meesmann. MECD is an autosomal dominant disease that causes fragility of the anterior corneal epithelium. Patients are usually asymptomatic until adulthood when rupture of the corneal microcysts may cause erosions, producing clinical symptoms such as photophobia, contact lens intolerance and intermittent diminution of visual acuity. Rarely, subepithelial scarring causes irregular corneal astigmatism and permanent visual impairment. Histological examination shows a disorganized and thickened epithelium with widespread cytoplasmic vacuolation and numerous small, round, debris-laden intraepithelial cysts.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Recombinant Human Cytokeratin 3 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human Cytokeratin 3 protein (ab114414)

ab114414 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114414.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up