Recombinant Human Cytokeratin 4 protein (ab112314)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP19013
    • SpeciesHuman
    • SequenceMIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSR SLYNLRGNKSISMSVAGSRQGACFGGAGGFGTGGFGAGGFGAGFGTGGFG GGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLTPLHVEIDPEIQKVRTE EREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTSSKNLEP LFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTA AENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTH VSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQ LQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADA EQRGENALKDAHSKRVELEAALQQAKEELARMLREYQELMSVKLALDIEI ATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGISGGLGSGSGFGLSS GFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR
    • Molecular weight85 kDa including tags
    • Amino acids1 to 534
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112314 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesab112314 is best use within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CK 4
    • CK-4
    • CK4
    • CYK4
    • Cytokeratin 4
    • Cytokeratin-4
    • Cytokeratin4
    • FLJ31692
    • K2C4_HUMAN
    • K4
    • Keratin
    • Keratin 4
    • Keratin type II cytoskeletal 4
    • Keratin-4
    • Keratin4
    • KRT 4
    • Krt4
    • type II cytoskeletal 4
    • Type-II keratin Kb4
    see all
  • Tissue specificityDetected in the suprabasal layer of the stratified epithelium of the esophagus, exocervix, vagina, mouth and lingual mucosa, and in cells and cell clusters in the mucosa and serous gland ducts of the esophageal submucosa (at protein level). Expressed widely in the exocervix and esophageal epithelium, with lowest levels detected in the basal cell layer.
  • Involvement in diseaseDefects in KRT4 are a cause of white sponge nevus of cannon (WSN) [MIM:193900]. WSN is a rare autosomal dominant disorder which predominantly affects non-cornified stratified squamous epithelia. Clinically, it is characterized by the presence of soft, white, and spongy plaques in the oral mucosa. The characteristic histopathologic features are epithelial thickening, parakeratosis, and vacuolization of the suprabasal layer of oral epithelial keratinocytes. Less frequently the mucous membranes of the nose, esophagus, genitalia and rectum are involved.
  • Sequence similaritiesBelongs to the intermediate filament family.
  • Information by UniProt

Recombinant Human Cytokeratin 4 protein images

  • 12.5% SDS-PAGE showing ab112314 stained with Coomassie Blue.

References for Recombinant Human Cytokeratin 4 protein (ab112314)

ab112314 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112314.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"