Recombinant Human Cytokeratin 5 protein (denatured) (ab180285)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSRQSSVSFRSGGSRSFSTASAITPSV SRTSFTSVSRSGGGGGGGFGRVSLAGACGVGGYGSRSLYNLGGSKRISIS TSGGSFRNRFGAGAGGGYGFGGGAGSGFGFGGGAGGGFGLGGGAGFGGGF GGPGFPVCPPGGIQEVTVNQSLLTPLNLQIDPSIQRVRTEEREQIKTLNN KFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLR RQLDSIVGERGRLDSELRNMQDLVEDFKNKYEDEINKRTTAENEFVMLKK DVDAAYMNKVELEAKVDALMDEINFMKMFFDAELSQMQTHVSDTSVVLSM DNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGD DLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKD ARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGE ECRLSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGG GSGSYYSSSSGGVGLSGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKF VSTTSSSRKSFKS
    • Molecular weight
      65 kDa including tags
    • Amino acids
      1 to 590
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (AAH24292)

Specifications

Our Abpromise guarantee covers the use of ab180285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.
    ab180285 is purified using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20 mM Tris pH 7.5, 2 mM EDTA.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • 58 kDa cytokeratin
    • CK-5
    • CK5
    • Cytokeratin-5
    • Cytokeratin5
    • DDD
    • DDD1
    • EBS2
    • epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types
    • K2C5_HUMAN
    • K5
    • Keratin
    • Keratin 5
    • keratin 5 (epidermolysis bullosa simplex, Dowling-Meara/Kobner/Weber-Cockayne types)
    • keratin complex 2, basic, gene 5
    • keratin, type II cytoskeletal 5
    • Keratin-5
    • Keratin5
    • KRT 5
    • Krt5
    • KRT5A
    • type II cytoskeletal 5
    • Type-II keratin Kb5
    see all
  • Involvement in disease
    Defects in KRT5 are a cause of epidermolysis bullosa simplex Dowling-Meara type (DM-EBS) [MIM:131760]. DM-EBS is a severe form of intraepidermal epidermolysis bullosa characterized by generalized herpetiform blistering, milia formation, dystrophic nails, and mucous membrane involvement.
    Defects in KRT5 are the cause of epidermolysis bullosa simplex with migratory circinate erythema (EBSMCE) [MIM:609352]. EBSMCE is a form of intraepidermal epidermolysis bullosa characterized by unusual migratory circinate erythema. Skin lesions appear from birth primarily on the hands, feet, and legs but spare nails, ocular epithelia and mucosae. Lesions heal with brown pigmentation but no scarring. Electron microscopy findings are distinct from those seen in the DM-EBS, with no evidence of tonofilament clumping.
    Defects in KRT5 are a cause of epidermolysis bullosa simplex Weber-Cockayne type (WC-EBS) [MIM:131800]. WC-EBS is a form of intraepidermal epidermolysis bullosa characterized by blistering limited to palmar and plantar areas of the skin.
    Defects in KRT5 are a cause of epidermolysis bullosa simplex Koebner type (K-EBS) [MIM:131900]. K-EBS is a form of intraepidermal epidermolysis bullosa characterized by generalized skin blistering. The phenotype is not fundamentally distinct from the Dowling-Meara type, althought it is less severe.
    Defects in KRT5 are the cause of epidermolysis bullosa simplex with mottled pigmentation (MP-EBS) [MIM:131960]. MP-EBS is a form of intraepidermal epidermolysis bullosa characterized by blistering at acral sites and 'mottled' pigmentation of the trunk and proximal extremities with hyper- and hypopigmentation macules.
    Defects in KRT5 are the cause of Dowling-Degos disease (DDD) [MIM:179850]; also known as Dowling-Degos-Kitamura disease or reticulate acropigmentation of Kitamura. DDD is an autosomal dominant genodermatosis. Affected individuals develop a postpubertal reticulate hyperpigmentation that is progressive and disfiguring, and small hyperkeratotic dark brown papules that affect mainly the flexures and great skin folds. Patients usually show no abnormalities of the hair or nails.
  • Sequence similarities
    Belongs to the intermediate filament family.
  • Information by UniProt

Images

  • 3 µg of ab180285 on a 15% SDS-PAGE gel, MW 64.8 KDa.

References

ab180285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up