Recombinant Human D Amino Acid Oxidase protein (ab117193)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMRVVVIGAGVIGLSTALCIHERYHSVLQPL DIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVH SPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGY GWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYII PGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLF GRILEEKKLSRMPPSHL
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 347
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab117193 is purified by proprietary chromatographic techniques and sterile filtered.
  • Form
    Liquid
  • Additional notes
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.02% DTT, 0.32% Tris HCl

General Info

  • Alternative names
    • D-amino-acid oxidase
    • DAAO
    • DAMOX
    • DAO
    • DAO1
    • EC 1.4.3.3
    • MGC35381
    • OXDA
    • OXDA_HUMAN
    see all
  • Function
    Regulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
  • Sequence similarities
    Belongs to the DAMOX/DASOX family.
  • Cellular localization
    Peroxisome.
  • Information by UniProt

References

ab117193 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up