Recombinant Human D Amino Acid Oxidase protein (ab117193)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP14920
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMRVVVIGAGVIGLSTALCIHERYHSVLQPL DIKVYADRFTPLTTTDVAAGLWQPYLSDPNNPQEADWSQQTFDYLLSHVH SPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPRELDMFPDYGY GWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYII PGTQTVTLGGIFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERT GFRPVRPQIRLEREQLRTGPSNTEVIHNYGHGGYGLTIHWGCALEAAKLF GRILEEKKLSRMPPSHL
    • Molecular weight42 kDa including tags
    • Amino acids1 to 347
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117193 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab117193 is purified by proprietary chromatographic techniques and sterile filtered.
  • FormLiquid
  • Additional notesFor long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.02% DTT, 0.32% Tris HCl

General Info

  • Alternative names
    • D-amino-acid oxidase
    • DAAO
    • DAMOX
    • DAO
    • DAO1
    • EC 1.4.3.3
    • MGC35381
    • OXDA
    • OXDA_HUMAN
    see all
  • FunctionRegulates the level of the neuromodulator D-serine in the brain. Has high activity towards D-DOPA and contributes to dopamine synthesis. Could act as a detoxifying agent which removes D-amino acids accumulated during aging. Acts on a variety of D-amino acids with a preference for those having small hydrophobic side chains followed by those bearing polar, aromatic, and basic groups. Does not act on acidic amino acids.
  • Sequence similaritiesBelongs to the DAMOX/DASOX family.
  • Cellular localizationPeroxisome.
  • Information by UniProt

References for Recombinant Human D Amino Acid Oxidase protein (ab117193)

ab117193 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117193.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"