Overview

  • Product name
    Recombinant Human DAAM1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPV EELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGAT SWPEFYIDQL
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAAM 1
    • Dishevelled associated activator of morphogenesis 1
    • FLJ41657
    • KIAA0666
  • Relevance
    DAAM1 (Dishevelled associated activator of morphogenesis 1) is a diaphanous-related formin which binds to dishevelled (Dvl) and Rho, and mediates Wnt-induced Dvl-Rho complex assembly. It is an essential component of noncanonical Wnt signaling. DAAM1 also communicates with Rho GTPases, CIP4 and Src in the regulation of the signalling pathways that co-ordinate the dynamics of the actin filament system. DAAM1 may be a coordinator of endocytosis and cytoskeletal remodeling.
  • Cellular localization
    Cytoplasmic. Note: Perinuclear.

Images

  • ab161497 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161497 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up