Overview

  • Product name
    Recombinant Human DAAM2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNI RFAELVDELDLTDKNREAMFALPPEKKWQIYCSKKKVPSLTPLATSQGSW HGVALAALACSCIHLMFITCQPCSRCWRNNSE
    • Amino acids
      1 to 132
    • Tags
      proprietary tag N-Terminus
    • Additional sequence information
      AAH47575

Specifications

Our Abpromise guarantee covers the use of ab161667 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DAAM2
    • DAAM2_HUMAN
    • Disheveled-associated activator of morphogenesis 2
    • dishevelled associated activator of morphogenesis 2
    • dJ90A20A.1
    • KIAA0381
    • MGC90515
    • RP1 278E11.1
    see all
  • Tissue specificity
    Expressed in most tissues examined.
  • Sequence similarities
    Belongs to the formin homology family.
    Contains 1 DAD (diaphanous autoregulatory) domain.
    Contains 1 FH1 (formin homology 1) domain.
    Contains 1 FH2 (formin homology 2) domain.
    Contains 1 GBD/FH3 (Rho GTPase-binding/formin homology 3) domain.
  • Information by UniProt

Images

  • ab161667 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161667 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161667.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up